Candidatus Thiothrix singaporensis: HZT40_17880
Help
Entry
HZT40_17880 CDS
T06729
Name
(GenBank) alpha/beta fold hydrolase
Organism
this
Candidatus Thiothrix singaporensis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Abhydrolase_1
Abhydrolase_4
Hydrolase_4
Motif
Other DBs
NCBI-ProteinID:
QLQ33149
UniProt:
A0A7L6AVK8
LinkDB
All DBs
Position
complement(3533214..3534779)
Genome browser
AA seq
521 aa
AA seq
DB search
MKKLIWALAGSLVVLSLLGIVSIHHXSRLSALVESISANGARFTPVDCWFTIGEGVRAQC
GWLYTAPAAGRPXSAFKLPVIVMQYQGLDRQPDPVVYLAGGXGAPAGLERKAVEGYWLGW
FQQKSGLKRDLVLFDQRGGGISRPDMECDGYRELSASILSHPGTPQENARRYREVARQCH
DQLQQRGLPLDELGTVYSAGDVNDLMQLLGYGQWNLWGVSYGTRLAFEVQRRYPDKVRSM
SLDSVYPPGEHLFRAWPDLLQGSLQRLFDFCQADNQCAMENGDLDARYQHLMAQLREHPL
EIPVADLHLGNLQELQLNDETLLAILFDSQYMSGSLREMAGMIRLLDEXHPERAMGFIQH
YLRQQFDASFREAAYWSVECRDNPPVARAEREAKINALPGLRDYLPYDYDLCDIWAADAD
EPLRLQDATEPRQVPTLLLAGQDDPITPAAWATKVAKQGFAEHRAYLFRFEGISHSVMDN
KPCAVDLFVNFINTPDQRPSADCRRSFRDSEKGALRSQGAS
NT seq
1566 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaactgatttgggcgctggcgggcagcctggtggttttgtctctattggggata
gtttcaatccatcattnntcgcgcctgtcagcactggtcgaaagcatttctgcaaatggg
gcgcggtttacgccagtcgactgctggttcactattggggaaggtgtccgggcgcaatgt
ggctggttatataccgcgcccgcggcgggcaggccatnntccgcattcaagcttcctgtc
atcgtcatgcaataccaagggctagaccgccagcctgacccggttgtgtacttggccggt
ggcnctggtgctccggcggggctggagcggaaagcggtggagggttattggctgggctgg
ttccaacaaaagtctgggctgaagcgcgacctggtgctgtttgaccagcgcggtggcggc
atcagccgacccgatatggaatgcgatggttatcgtgagttgagcgccagcatactttcc
caccctggaacgccgcaggagaatgcgcgccgctaccgggaagtcgcccgccaatgccat
gaccagttgcaacagcgcggcctgccgctggatgagttggggactgtttatagcgccggt
gatgtgaatgacctgatgcaattgctggggtatgggcagtggaatttgtggggcgtctcg
tatgggactcggctggcgtttgaagtgcagcggcgctaccccgacaaggtgcgcagcatg
agcctcgattccgtttacccgccgggtgagcatctgttccgcgcctggccggatttgttg
cagggcagtttgcagcgcctgttcgacttttgccaggcggataaccagtgtgcgatggag
aacggtgaccttgacgcgcgttaccagcatctgatggcgcaactgcgggagcatccgctg
gagattccggtggcagacttgcatttgggcaacttgcaggaattgcagctgaatgacgaa
accctgctggcgatcctgttcgattcccaatacatgagcggcagcctcagggaaatggcg
ggtatgatccgcctattggatgagnggcaccccgagagggcgatgggcttcattcagcat
tacctgcgccagcaatttgatgcgtcattccgggaggcggcctactggtcggtggaatgc
cgggacaatccgccagtcgcacgggcagagcgggaggccaagatcaacgctttgcccgga
ttgcgggattacctgccttacgactacgatttatgcgacatttgggcggcggatgctgac
gaaccgctgcgtttgcaggacgctacagaaccacgccaggtgccgacgctgttgctggcg
ggtcaggatgacccgattaccccggcggcatgggcgaccaaggttgccaagcaagggttt
gctgaacaccgagcctatttgttccgttttgaagggatttcacacagtgtcatggacaac
aagccctgcgcagttgatttgttcgtgaatttcatcaatacaccagaccagcgcccgagt
gcggactgccgtcggagtttcagggattctgaaaagggggcgctgcgttcccaaggcgct
agttga
DBGET
integrated database retrieval system