Candidatus Thiothrix singaporensis: HZT40_20540 Help Entry HZT40_20540       CDS       T06729                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism this  Candidatus Thiothrix singaporensis Pathway this01100   Metabolic pathways this01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:this00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HZT40_20540    00074 Mycolic acid biosynthesis     HZT40_20540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HZT40_20540 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QLQ34317 UniProt:  A0A7L6AZH6 LinkDB All DBs Position 4071419..4071661 Genome browser AA seq 80 aa AA seqDB search MTPDRVAVEGLIGQLKEIISEKMDVNISRDEINPDVSLFEDGLGLDSIAIVEFITLIEEN TGYRFKEGGLDMDNFKTYAH NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgccagacagagttgcggttgaaggtttgattgggcaattgaaagaaattatttct gaaaagatggatgtgaatatcagccgggatgagattaatcctgatgtctctttatttgag gacggtttggggctggattcaatcgccattgtggaattcattacgctgattgaagaaaac accggctaccgcttcaaggaaggtggtttggatatggataatttcaaaacttacgcacat tag

DBGET integrated database retrieval system