Tarenaya hassleriana (spider flower): 104805609 Help Entry 104805609         CDS       T04125                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism thj  Tarenaya hassleriana (spider flower) Pathway thj04016   MAPK signaling pathway - plant thj04070   Phosphatidylinositol signaling system thj04075   Plant hormone signal transduction thj04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:thj00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     104805609    04070 Phosphatidylinositol signaling system     104805609    04075 Plant hormone signal transduction     104805609  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     104805609  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:thj01009]     104805609   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:thj04131]     104805609    03036 Chromosome and associated proteins [BR:thj03036]     104805609   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thj04147]     104805609 Protein phosphatases and associated proteins [BR:thj01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104805609 Membrane trafficking [BR:thj04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104805609 Chromosome and associated proteins [BR:thj03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104805609 Exosome [BR:thj04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104805609 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  104805609 NCBI-ProteinID:  XP_010528533 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKIMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcaactcaccgacgaccagatctctgagttcaaggaggcttttagcctcttc gacaaggatggcgatggctgcataaccaccaaggagctgggaacagtgatgcgctctctc gggcagaacccaacagaagccgagctccaagacatgatcaacgaagttgacgcagacggg aacgggaccatcgacttcccggaatttctaaacctaatggctcgtaagatgaaagacacg gactcggaggaagagctcaaggaggcattcagggtcttcgacaaggaccagaacggcttc atctcagcggccgagctgcgtcacgtcatgaccaatctgggggagaagcttacggacgag gaggtggacgagatgatccgtgaggctgacgtggatggggacggccagatcaactacgaa gagttcgtgaagatcatgatggctaagtga

DBGET integrated database retrieval system