KEGG   Tarenaya hassleriana (spider flower): 104806926
Entry
104806926         CDS       T04125                                 
Name
(RefSeq) cytochrome P450 83B1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00380  Tryptophan metabolism
thj00966  Glucosinolate biosynthesis
thj01100  Metabolic pathways
thj01110  Biosynthesis of secondary metabolites
thj01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:thj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    104806926
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104806926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:thj00199]
    104806926
Enzymes [BR:thj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     104806926
Cytochrome P450 [BR:thj00199]
 Cytochrome P450, plant type
  CYP83 family
   104806926
SSDB
Motif
Pfam: p450 Goodbye FANCI_S2 D-Glu_cyclase
Other DBs
NCBI-GeneID: 104806926
NCBI-ProteinID: XP_010530341
LinkDB
Position
Unknown
AA seq 498 aa
MDLFLILAAAIAVAAFFLLRGSKKSVRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKLY
GPIFSMKIGSRRLVVISSAELSKDLLKTQDLNFTARPLLKGQQTMSYRGRELGFGQYTPY
YREMRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYKASDSSGTVDLSELLMSFTNCVV
CRQAFGKRYNEYGNEMKRFINILYETQALLGTFFFSDLFPYLGFLDDVTGLNARLKRAFK
ELDTYLQELLDETLDPNRPKPERESFIDLLMEIYRDQPFSVKFTYENVKAMILDIVVPGT
DTAAAVVVWAMTYLIKYPEAMKKAQAEVRNLIGDRGYVTEEDIANLPYLKAVVKESLRLE
PVIPILLPRETIADTKLGGYDIPAKTIVQVNAWAVSRDQAAWGENPNEFVPERFMGDHKG
VDFKGQDFELLPFGSGRRMCPAMHLGVAMLEIPFANLLYRFDWSLPKGMKPEDIKMDVMT
GLAMHKKDHLVVAPTKRF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggatctcttcctcatcttggctgcggccatagccgtggccgccttcttccttctccgc
ggctcgaagaaatccgtccggctccctccgggtccgaaggggcttccgatcatcggaaac
cttcaccagatggagaaattcaatccgcaacactttcttttccgtctctcgaagctttac
ggaccgatcttctccatgaagatcggctcgagacgcctcgtggtgatctcctccgcggaa
ttatctaaagatcttctcaagacgcaagacctcaacttcacggctcgtcctctgctcaaa
ggccagcagacgatgtcgtaccgcggccgtgagctgggtttcggacagtacacaccttat
taccgcgagatgaggaagatgtgcatggtcaacctctttagccctaaccgggtcgcgagc
tttcgacccgtcagagaggaagagtgtcagcgtatgatggataagatctacaaagcctcg
gacagttccggcaccgtggatctcagcgaacttctcatgtcgttcaccaactgcgtcgtg
tgcagacaagcgttcgggaaaaggtacaacgagtacggtaacgagatgaagaggttcatc
aacatcttgtacgagactcaagctcttctgggtacgtttttcttctccgacctctttccg
tacctcggatttctcgatgacgtcaccggtctcaacgctcggctcaagagagctttcaag
gagctcgacacttacttgcaagagcttctcgatgagacgctcgacccgaaccggccgaaa
cccgagagggaaagctttatcgatcttctgatggaaatctacagagatcaacctttctcc
gttaagttcacttacgagaacgtcaaagccatgattttggacatagttgttccgggaacc
gacacagctgctgcggtcgtggtttgggcaatgacgtacctcataaagtaccctgaagcc
atgaagaaagctcaagccgaggtcagaaacttgattggagacagaggatacgtaaccgaa
gaagacattgccaatcttccgtacttaaaagccgtagtgaaagagtctctccgcctcgag
cccgtgatcccgatccttctcccccgtgaaaccatcgcagacacgaagctcggtggctac
gacatacccgcgaagacgatcgtgcaggtgaacgcgtgggccgtgtcccgcgaccaagcc
gcgtggggagagaatccgaacgagttcgtgccagagaggttcatgggcgaccacaagggc
gtggacttcaaggggcaagactttgagctcttgcccttcggctcgggtcgcaggatgtgt
ccggcgatgcacttgggcgtcgccatgctcgagatccccttcgccaaccttctctaccgt
ttcgactggagcttgcccaaaggaatgaagcctgaggacatcaagatggacgtcatgact
ggcctcgcaatgcacaagaaagaccacctcgttgttgccccgacaaagcgcttctga

DBGET integrated database retrieval system