Tarenaya hassleriana (spider flower): 104808788 Help Entry 104808788         CDS       T04125                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism thj  Tarenaya hassleriana (spider flower) Pathway thj03083   Polycomb repressive complex thj04120   Ubiquitin mediated proteolysis thj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:thj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104808788    04120 Ubiquitin mediated proteolysis     104808788   09126 Chromosome    03083 Polycomb repressive complex     104808788  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:thj04131]     104808788    04121 Ubiquitin system [BR:thj04121]     104808788    03036 Chromosome and associated proteins [BR:thj03036]     104808788 Membrane trafficking [BR:thj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104808788 Ubiquitin system [BR:thj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104808788    Cul7 complex      104808788 Chromosome and associated proteins [BR:thj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104808788   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104808788 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 DUF5740 PilJ_Pilin Motif Other DBs NCBI-GeneID:  104808788 NCBI-ProteinID:  XP_010532893 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MSIKLQSKDGEVFEVEKKVAKMSTIIAFMMEDVEDGIIPIPVAAAPTLSKALEYCKHHVS EPKPEPDPKDWDAKFMRQFDGNFPELVEFMKLASYLDIKGMLDLAASKAADFIKDKSVEE VRELFGSENDYTAEEEKALRAEFPWAF NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtcgattaagcttcagtccaaagacggagaagtgttcgaggtcgagaagaaggtggca aagatgtcgaccatcatagcattcatgatggaggacgtggaggatggcataatccccatc cccgtagccgccgccccgaccctctccaaggccctggagtactgcaagcaccacgtgtcc gagccgaaacccgaaccggaccccaaggattgggacgcgaagttcatgagacagtttgac gggaatttccccgagctggtggagtttatgaagctggcctcgtatctggacataaagggt atgctggatctggccgcgtcaaaggccgcggatttcatcaaggacaagtcggtcgaggaa gtccgagagcttttcggcagcgagaacgattacacggccgaggaggagaaggctctacgc gccgagtttccatgggctttttag

DBGET integrated database retrieval system