Tarenaya hassleriana (spider flower): 104809805 Help Entry 104809805         CDS       T04125                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism thj  Tarenaya hassleriana (spider flower) Brite KEGG Orthology (KO) [BR:thj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thj03036]     104809805   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thj04147]     104809805 Chromosome and associated proteins [BR:thj03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104809805 Exosome [BR:thj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104809805 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  104809805 NCBI-ProteinID:  XP_010534185 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacgaagcaaactgctcgtaaatcgactggaggaaaggctccgaggaagcaa ctcgccactaaggccgcgaggaaatctgctccgaccaccggaggagtgaagaagcctcac cgctaccgtcctggaaccgtcgcccttcgtgaaattcgcaagtaccagaagagcacggag ttgttgatccgtaagcttccgtttcagcgtcttgttcgtgaaattgcccaggacttcaag acggatctgaggttccagagccatgcggtgttggctcttcaggag

DBGET integrated database retrieval system