Tarenaya hassleriana (spider flower): 104813778 Help Entry 104813778         CDS       T04125                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism thj  Tarenaya hassleriana (spider flower) Pathway thj03083   Polycomb repressive complex thj04120   Ubiquitin mediated proteolysis thj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:thj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104813778    04120 Ubiquitin mediated proteolysis     104813778   09126 Chromosome    03083 Polycomb repressive complex     104813778  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:thj04131]     104813778    04121 Ubiquitin system [BR:thj04121]     104813778    03036 Chromosome and associated proteins [BR:thj03036]     104813778 Membrane trafficking [BR:thj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     104813778 Ubiquitin system [BR:thj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      104813778    Cul7 complex      104813778 Chromosome and associated proteins [BR:thj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      104813778   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      104813778 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 DUF7443 Motif Other DBs NCBI-GeneID:  104813778 NCBI-ProteinID:  XP_010539834 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MSSAAEKKIILKSSDGVVFEIDKAVAMESQTITHLIEDDCAGDAIPIPEVTSKILWMVIE YSMKHVAAAAAADGALKAWDAEFVKVDNATLVDLILAANYLNIEGLLDLTCQRVADMIGN SRNPEEIREKLNIENDFTAEELKDLNARINWAFR NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtcgtccgcggcggagaagaagatcatcctgaaatcctctgacggagtggtctttgag atcgacaaggccgtcgcgatggaatctcagaccataacgcatttgatcgaggacgattgc gccggtgatgcgatcccgatcccggaagttacgagcaagatcctctggatggtcatcgaa tactccatgaagcacgtggccgccgccgccgccgccgacggcgccctcaaggcgtgggac gccgagttcgtcaaagtcgataacgctacgctcgtcgatctcatcctggcggcaaattac ctcaacatagaggggcttcttgacctaacctgccagagagtggcggatatgatcggaaac agcagaaatcccgaggaaattcgcgagaagctcaacatcgagaatgatttcacggccgag gaactaaaagacttgaacgccaggattaattgggcgtttcgatga

DBGET integrated database retrieval system