Tarenaya hassleriana (spider flower): 104818942 Help Entry 104818942         CDS       T04125                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism thj  Tarenaya hassleriana (spider flower) Pathway thj03018   RNA degradation thj03040   Spliceosome Brite KEGG Orthology (KO) [BR:thj00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     104818942   09123 Folding, sorting and degradation    03018 RNA degradation     104818942  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:thj03019]     104818942    03041 Spliceosome [BR:thj03041]     104818942 Messenger RNA biogenesis [BR:thj03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      104818942   mRNA degradation factors    5'-3' decay     Lsm complex      104818942 Spliceosome [BR:thj03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     104818942 SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  104818942 NCBI-ProteinID:  XP_010547049 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITSEGR RITKLDQILLNGNNIAILVPGGSPEAE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcgaacaatccatcgcagcttcttccatcagagttgatcgacaggtgcataggatcg aagatatgggtaataatgaaaggagacaaggagcttgtgggtactctccgagggttcgat gtttacgtcaacatggtccttgaggatgtcaccgagtatgagattacatcggaagggaga aggatcacaaagctcgatcagatattgcttaacggcaacaacattgccattctggttcct ggtggctctccagaggcagaatga

DBGET integrated database retrieval system