Tarenaya hassleriana (spider flower): 104821724 Help Entry 104821724         CDS       T04125                                  Name (RefSeq) sm-like protein LSM4   KO K12623   U6 snRNA-associated Sm-like protein LSm4 Organism thj  Tarenaya hassleriana (spider flower) Pathway thj03018   RNA degradation thj03040   Spliceosome Brite KEGG Orthology (KO) [BR:thj00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     104821724   09123 Folding, sorting and degradation    03018 RNA degradation     104821724  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:thj03019]     104821724    03041 Spliceosome [BR:thj03041]     104821724 Messenger RNA biogenesis [BR:thj03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      104821724   mRNA degradation factors    5'-3' decay     Lsm complex      104821724 Spliceosome [BR:thj03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     104821724 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  104821724 NCBI-ProteinID:  XP_010550988 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY IRGNTIKYLRVPDEVIDKVQEEKSRTDRKPPGVGRGRGGRGEGPGRVLGRGMDDGAARGR GRGGPIGNKGGGRGRG NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgcttcctctttctttgctcaagactgcccaagggcatcccatgcttgtggagcttaag aacggtgaaacctacaacgggcacttggtcaattgtgatacttggatgaacattcatctt cgtgaagttatctgtacatcaaaggatggagaccggttttggaggatgccggagtgttac atccgtggcaacacgattaaatatcttcgagttccagatgaggttattgataaagtgcaa gaggagaagagccgcacagatagaaaaccgccgggagttggacgtggaagaggaggacgg ggtgaaggtcctggaagggtacttgggcgtggcatggatgatggagctgccagaggccgt ggcagaggaggtcctattggcaacaaaggaggcggccgtggacgtggttga

DBGET integrated database retrieval system