Tarenaya hassleriana (spider flower): 104821867 Help Entry 104821867         CDS       T04125                                  Name (RefSeq) ras-related protein Rab7   KO K07897   Ras-related protein Rab-7A Organism thj  Tarenaya hassleriana (spider flower) Pathway thj04144   Endocytosis thj04145   Phagosome thj04148   Efferocytosis Brite KEGG Orthology (KO) [BR:thj00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104821867    04145 Phagosome     104821867    04148 Efferocytosis     104821867  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:thj04131]     104821867   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thj04147]     104821867    04031 GTP-binding proteins [BR:thj04031]     104821867 Membrane trafficking [BR:thj04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     104821867 Exosome [BR:thj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104821867   Exosomal proteins of other body fluids (saliva and urine)    104821867   Exosomal proteins of colorectal cancer cells    104821867   Exosomal proteins of bladder cancer cells    104821867 GTP-binding proteins [BR:thj04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     104821867 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA ATP_bind_1 RsgA_GTPase AAA_16 nSTAND3 Septin cobW AAA_7 PduV-EutP AAA_22 AAA_24 NTPase_1 ATPase_2 SRPRB MCM NACHT AAA_14 ATP-synt_ab NB-ARC AAA_5 ABC_tran TniB Motif Other DBs NCBI-GeneID:  104821867 NCBI-ProteinID:  XP_019058993 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWRDEFLIQASPSDPENFPF VVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEDAFQCIAKNALK NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcgtagacgaaccctcctaaaagtcatcatcctcggagatagcggggtgggg aagacctcgctgatgaatcaatatgtaaataaaaagttcagtaaccagtacaaggctact atcggggctgacttcttgaccaaggaagtacaatttgaagaccggcttttcacattacag atatgggacacagctggacaggaaaggtttcagagccttggggtagccttttaccgtggt gctgattgctgtgttctcgtatacgatgtcaattccatgaaatcattcgagaatctcaac aactggagggatgaatttctgatccaggcgagtccatcagatccggagaatttcccattt gttgttattggaaataagatcgatgtggatggtggaaacagtcgtgtggtttcagagaaa aaagctcgagcatggtgcgcctccaaaggaaacattccatactttgagacctctgccaag gaaggcaccaatgtagaagatgctttccagtgcatagccaagaacgcgttgaagtga

DBGET integrated database retrieval system