Thauera sp. K11: CCZ27_04530 Help Entry CCZ27_04530       CDS       T05106                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism thk  Thauera sp. K11 Pathway thk00361   Chlorocyclohexane and chlorobenzene degradation thk00362   Benzoate degradation thk00623   Toluene degradation thk01100   Metabolic pathways thk01120   Microbial metabolism in diverse environments thk01220   Degradation of aromatic compounds Module thk_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:thk00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CCZ27_04530    00361 Chlorocyclohexane and chlorobenzene degradation     CCZ27_04530    00623 Toluene degradation     CCZ27_04530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  ATE59315 UniProt:  A0A290ZJX9 LinkDB All DBs Position 1042630..1042893 Genome browser AA seq 87 aa AA seqDB search MEKDKPTVDLSRKYVRLIERRADGFVEFEFAIGEPELYAEMLLPEEAYEAFCKANEVIHL GPREASAESEGSEWDWNLHQATHQRFR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggagaaagacaaacccacggtagacctgtcccggaagtacgtgcgcctgatcgagcgc cgtgccgacgggttcgtcgagttcgagttcgccatcggcgaacccgagctttacgcggaa atgctgctgcccgaggaggcgtacgaagcgttctgcaaagccaacgaggtgattcacctc gggccgcgcgaggcgtcggccgagtccgagggttccgagtgggactggaacctgcatcag gcaacccatcagcgattccgttga

DBGET integrated database retrieval system