Thauera sp. K11: CCZ27_04540 Help Entry CCZ27_04540       CDS       T05106                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism thk  Thauera sp. K11 Pathway thk00361   Chlorocyclohexane and chlorobenzene degradation thk00362   Benzoate degradation thk00623   Toluene degradation thk01100   Metabolic pathways thk01120   Microbial metabolism in diverse environments thk01220   Degradation of aromatic compounds Module thk_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:thk00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CCZ27_04540    00361 Chlorocyclohexane and chlorobenzene degradation     CCZ27_04540    00623 Toluene degradation     CCZ27_04540 Enzymes [BR:thk01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CCZ27_04540     1.14.13.244  phenol 2-monooxygenase (NADH)      CCZ27_04540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Methyltransf_12 Motif Other DBs NCBI-ProteinID:  ATE59317 UniProt:  A0A290ZJV7 LinkDB All DBs Position 1043932..1044201 Genome browser AA seq 89 aa AA seqDB search MSTVFIALQTNEETRPIIEAILQDNPTAVVDEQPAMVKINAERELVVRRETIEEITGSEY DLQSLQVNLITMSGNLDQTDDEIRLFWKA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccgtattcatcgcgctgcaaacgaacgaagaaacccgcccgatcatcgaggcg atcctgcaggacaacccgacggcggtggtggatgagcagcccgccatggtgaagatcaac gccgaacgcgaactggtggtccgccgcgagacgatcgaggagatcaccggcagcgagtac gacctgcagtcgctgcaggtgaacctgatcacgatgtcgggcaacctggaccagaccgac gacgaaatccgccttttctggaaggcttga

DBGET integrated database retrieval system