Thauera sp. K11: CCZ27_04610 Help Entry CCZ27_04610       CDS       T05106                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism thk  Thauera sp. K11 Pathway thk00362   Benzoate degradation thk00621   Dioxin degradation thk00622   Xylene degradation thk01100   Metabolic pathways thk01120   Microbial metabolism in diverse environments thk01220   Degradation of aromatic compounds Module thk_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:thk00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CCZ27_04610    00622 Xylene degradation     CCZ27_04610    00621 Dioxin degradation     CCZ27_04610 Enzymes [BR:thk01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CCZ27_04610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 FTCD_C WS_DGAT_cat Motif Other DBs NCBI-ProteinID:  ATE59327 UniProt:  A0A290ZJW7 LinkDB All DBs Position 1056078..1056269 Genome browser AA seq 63 aa AA seqDB search MPLAEITMIEGRTEDQKRAVIEKVTQALVEAVGAPIQTVRVVIREVPKTNWGIGGVSAKD LGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgccgttggccgaaatcacgatgatcgaagggcgtaccgaagaccagaagcgtgcggtg atcgagaaggtcacgcaggcgctggtggaggcggtgggcgctcccatccagaccgtgcgc gtcgtcatccgcgaggttccgaagacgaactggggtatcggcggggtgtctgcgaaggat ctggggcgctga

DBGET integrated database retrieval system