KEGG   Thauera sp. K11: CCZ27_05880
Entry
CCZ27_05880       CDS       T05106                                 

Name
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
thk  Thauera sp. K11
Brite
KEGG Orthology (KO) [BR:thk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCZ27_05880
Enzymes [BR:thk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     CCZ27_05880
SSDB
Motif
Pfam: PQQ_2 PQQ PQQ_3
Other DBs
NCBI-ProteinID: ATE62500
UniProt: A0A290ZU34
LinkDB
Position
complement(1343911..1345791)
AA seq 626 aa
MSIRANRRVAPKALTLALAAALSLPAAAGADVSWDDIANDHKTPGDVLSYGLGLKAQRHS
PLKQINTKTVAGLVPAWSFSFGGEKQRGQEGQVLVHDGMIYATGSYSRFFAIDARTGKRQ
WEYDHRLPDDIRPCCDVVNRGAAIYGDKVFFGTLDAAIVALDRKTGKVVWRNKFADHKVG
YTMTGAPFIVKDQKSGRVLLVHGSSGDEFGVVGWLYARDPDTGEEVWARPLVEGHMGRLH
GKDSTPTGNPKAPSWPDDPNSPTGKVEAWSHGGGAPWQTASFDAENNMIVIGAGNPAPWN
TWKRTAPGDDPRNWDSLFTSGQAYVDAATGELKGFYQHTPNDAWDFSGNNSVVLFEYKDP
KTGKMVNASAHADRNGFFFVTDRDKLAKGSGYPNRPTSLIGAWPFVDGITWASGFDLATG
KPIEKNNRPQLPKDGADKGESIFVSPPFLGGTNWHPMSYSPDTGLFYIPANHWAMDYWTE
NVTYKAGSAYLGQGFRIKKLFDDHVGILRAIDPVSGKIAWEHKETFPLWAGTLTTAGGLV
FTGTSDGYLKAFDAKNGKELWKFQTGSGVVSVPVTWEMDGEQYVAIQSGYGGAVPLWGGD
MADLTKQVTQGGSLWVFKLPRQLAAN
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgagcatccgagcaaaccggcgcgtcgcgccgaaagcactgaccctcgcgctggcggcg
gcgctgtcgttgccggcggcggcgggcgccgacgtcagttgggatgacatcgccaacgac
cacaagacgccgggcgacgtgctctcctacggcctcggcctgaaggcgcagcgccacagc
ccgctcaagcagatcaacacgaagaccgtcgccgggctggtgccggcgtggagcttttcc
ttcggcggcgaaaagcagcgcggccaggaagggcaggtgctggtgcacgacggcatgatc
tacgccaccggctcctattcgcgcttctttgccatcgacgcgcgcaccggcaagcgccag
tgggaatacgaccatcgcctgcccgacgacatccggccgtgttgcgacgtggtcaaccgc
ggcgcggcgatctatggcgacaaggtcttcttcggcacgctggacgcggccatcgtcgcg
ctcgacaggaagaccggcaaggtcgtgtggcgcaacaagttcgccgaccacaaggtcggc
tacacgatgaccggcgcccccttcatcgtgaaggaccagaagagcggccgcgtgctgctc
gtgcatggctcgtccggcgacgagttcggcgtggtcggctggctgtacgcgcgcgacccc
gacaccggcgaggaagtgtgggcgcggccgctggtcgagggccacatggggcggctccac
ggcaaggacagcacgcccaccggcaacccgaaggcaccgagctggccggacgaccccaac
tcgcccaccggcaaggtcgaagcctggagccacggcggcggcgcgccgtggcagacggca
agcttcgacgcggaaaacaacatgatcgtcatcggcgccggcaaccccgcgccgtggaac
acctggaagcgcaccgcacccggcgacgacccgcgcaactgggacagcctgttcacctcc
ggccaggcttacgtcgatgccgccaccggcgaactcaagggcttctaccagcacaccccg
aacgacgcctgggacttttccggcaacaactcggtggtgctgttcgaatacaaggacccg
aagaccggcaagatggtcaacgcctcggcccacgccgaccgcaacggcttcttcttcgtc
accgaccgcgacaagctcgccaagggctcgggctaccctaacaggccgacctcgctgatc
ggcgcctggccgttcgtggacggcataacctgggcatccggtttcgatctggcgaccggc
aagccgatcgagaagaacaaccgcccgcaacttcccaaggatggagccgacaagggcgaa
tcgatcttcgtctcgccgcccttcctcggcggcaccaactggcacccgatgtcctacagc
cccgacacgggcctgttctacatccccgccaaccactgggcgatggactactggaccgag
aacgtcacctacaaggcgggctccgcctatctcggccagggcttccgcatcaagaagctg
ttcgacgaccacgtcggcatcctgcgcgccatcgacccggtcagcggcaagatcgcatgg
gaacacaaggagaccttcccgctgtgggccggcacgctgaccactgccggcgggctggtc
ttcaccggcacgtccgacggctacctgaaggctttcgacgccaagaacggcaaggaactg
tggaagttccagaccggctcgggcgtcgtgtcggtgccggtgacgtgggagatggacggc
gagcagtacgtggccatccagtccggctacggcggcgccgtgccgctgtggggcggagac
atggccgacctgaccaagcaggtcacccagggcggctcgctgtgggtgttcaaactgccc
aggcaactcgccgccaactga

DBGET integrated database retrieval system