Thauera sp. K11: CCZ27_05985 Help Entry CCZ27_05985       CDS       T05106                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism thk  Thauera sp. K11 Brite KEGG Orthology (KO) [BR:thk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thk03036]     CCZ27_05985 Chromosome and associated proteins [BR:thk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CCZ27_05985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC DUF7330 Motif Other DBs NCBI-ProteinID:  ATE59561 UniProt:  A0A290ZKR3 LinkDB All DBs Position 1371787..1372062 Genome browser AA seq 91 aa AA seqDB search MRWPVLILFVLVVVLQYPLWLGKGGWLRVWEVDRQVQAQRDENLRLEQRNASLDAEVRDL KSGNDAIEERARFELGLTRPGEVYVQVPQKN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcgctggcctgtcctgatcctcttcgtgctcgtcgtcgtcctgcagtacccgctctgg ctgggcaagggcggctggctgcgcgtgtgggaagtggatcgccaagtgcaggcgcagcgc gacgagaacctgcgcctggagcagcgcaacgccagcctggatgcggaagtgcgcgacctc aagtcgggcaacgacgcgatcgaggagcgcgcgcgcttcgaactcggcctgacccgcccg ggcgaggtctacgtgcaggtgccgcagaaaaactga

DBGET integrated database retrieval system