Thauera sp. K11: CCZ27_07220 Help Entry CCZ27_07220       CDS       T05106                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thk  Thauera sp. K11 Pathway thk01100   Metabolic pathways thk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CCZ27_07220    00074 Mycolic acid biosynthesis     CCZ27_07220   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CCZ27_07220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  ATE59767 LinkDB All DBs Position 1636239..1636478 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKNDSSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITNVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaagaagatcgtcgctgagcaacttggcgtgaacgaa tcggaaatcaagaacgattcttcgttcgttgatgatcttggcgcagattcgctggacacc gtggaactggtcatggcgctcgaagaagaattcgagtgcgaaattccggacgaagaagct gagaagatcaccaacgtccagcaggcgatcgactacgtcaacgcccatctcaagaagtaa

DBGET integrated database retrieval system