Thauera sp. K11: CCZ27_10680 Help Entry CCZ27_10680       CDS       T05106                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism thk  Thauera sp. K11 Pathway thk00361   Chlorocyclohexane and chlorobenzene degradation thk00362   Benzoate degradation thk00623   Toluene degradation thk01100   Metabolic pathways thk01120   Microbial metabolism in diverse environments thk01220   Degradation of aromatic compounds Module thk_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:thk00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CCZ27_10680    00361 Chlorocyclohexane and chlorobenzene degradation     CCZ27_10680    00623 Toluene degradation     CCZ27_10680 Enzymes [BR:thk01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CCZ27_10680     1.14.13.244  phenol 2-monooxygenase (NADH)      CCZ27_10680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  ATE60355 UniProt:  A0A290ZMW3 LinkDB All DBs Position 2452165..2452521 Genome browser AA seq 118 aa AA seqDB search MAVVALKEYVGVSRDRVENFHGKQLVYVAWDYHMLFAAPFMFCVEPQMKLGELVRGPLSA LMQPDPDAAAVDWGKVEWLKLGQPWTPDFERSLEENGIGHKEQLRFRTPGLNTLRDAA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcagtagtagccttgaaggaatacgtcggcgtctcgcgcgaccgcgtcgagaatttc catggcaagcaactcgtttacgtggcgtgggactaccacatgttgttcgccgcaccgttc atgttctgcgtcgagccgcagatgaagctcggcgagctcgtccgcggcccgctgagcgcc ctgatgcagcccgatccagatgcggctgcggtcgactggggcaaggtagagtggctgaag cttggccagccgtggaccccggacttcgagcgcagcctcgaagagaacggtattggccac aaggaacagctgcgtttccgcaccccgggcctaaacacgctgcgcgacgcggcttaa

DBGET integrated database retrieval system