Thermococcus cleftensis: CL1_0585 Help Entry CL1_0585          CDS       T02169                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism thm  Thermococcus cleftensis Pathway thm03010   Ribosome Brite KEGG Orthology (KO) [BR:thm00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CL1_0585   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CL1_0585  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thm03011]     CL1_0585    04121 Ubiquitin system [BR:thm04121]     CL1_0585 Ribosome [BR:thm03011]  Ribosomal proteins   Eukaryotes    Large subunit     CL1_0585   Archaea     CL1_0585 Ubiquitin system [BR:thm04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CL1_0585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Zn_ribbon_RPAB4 DZR Ribosomal_L40e Toxin_5 DZR_2 Zn_ribbon_10 Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  AFL94792 UniProt:  I3ZSV8 LinkDB All DBs Position complement(543926..544084) Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYICMRCGATNPWKAKKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagattcccagaggctgaggccagaatctttaggaagtacatttgcatgcgctgc ggcgctaccaacccgtggaaggccaagaagtgcaggaagtgcggctacaagggtctccgc ccgaaggctagagagccgcgcggtggaatgggacgctga

DBGET integrated database retrieval system