Thermococcus cleftensis: CL1_0762 Help Entry CL1_0762          CDS       T02169                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism thm  Thermococcus cleftensis Pathway thm03010   Ribosome Brite KEGG Orthology (KO) [BR:thm00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CL1_0762   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CL1_0762  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thm03011]     CL1_0762    04121 Ubiquitin system [BR:thm04121]     CL1_0762   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thm04147]     CL1_0762 Ribosome [BR:thm03011]  Ribosomal proteins   Eukaryotes    Small subunit     CL1_0762   Archaea     CL1_0762 Ubiquitin system [BR:thm04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CL1_0762 Exosome [BR:thm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CL1_0762   Exosomal proteins of colorectal cancer cells    CL1_0762 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB MqsA_antitoxin Ribosomal_L37e Lar_restr_allev Zn_ribbon_IS1595 Zn_ribbon_RPB9 Zn_ribbon_Nudix Motif Other DBs NCBI-ProteinID:  AFL94967 UniProt:  I3ZTD3 LinkDB All DBs Position 692627..692794 Genome browser AA seq 55 aa AA seqDB search MAKRKSQKWKMYEVQGGKVKRKGKFCPRCGPGVFMAEHKDRWSCGRCGYTEWKRK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atggccaagaggaagagccagaagtggaagatgtacgaggttcagggcggtaaggtcaag aggaagggcaagttctgcccgcgctgcggtcctggagtcttcatggccgagcacaaggac cgctggagctgcggccgctgcggctacaccgagtggaagaggaagtga

DBGET integrated database retrieval system