Thermosynechococcus sp. NK55: NK55_08075 Help Entry NK55_08075        CDS       T02977                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism thn  Thermosynechococcus sp. NK55 Pathway thn02024   Quorum sensing thn03018   RNA degradation Brite KEGG Orthology (KO) [BR:thn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NK55_08075 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NK55_08075 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:thn03019]     NK55_08075 (hfq)    03036 Chromosome and associated proteins [BR:thn03036]     NK55_08075 (hfq) Messenger RNA biogenesis [BR:thn03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NK55_08075 (hfq) Chromosome and associated proteins [BR:thn03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NK55_08075 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq Coat_X Motif Other DBs NCBI-ProteinID:  AHB88894 LinkDB All DBs Position 1690305..1690523 Genome browser AA seq 72 aa AA seqDB search MTDEFNTALPSIRQVQTFIKDSTEVEVKLSTSDLVVGKVRWQDTNCLCVVDHYDQPTIIW KQAIVFIKPKLA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacggatgaatttaacacggcactgcctagcattcgccaagtacagaccttcattaaa gatagcaccgaggttgaagtcaagctcagcaccagcgatcttgtggttggcaaagtgcgc tggcaggatacgaattgcctctgcgttgtcgatcactatgatcaacccacaattatttgg aagcaggccattgtctttattaaaccgaagctagcctaa

DBGET integrated database retrieval system