Candidatus Thioglobus autotrophicus: SP60_04210 Help Entry SP60_04210        CDS       T04079                                  Name (GenBank) hypothetical protein   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism tho  Candidatus Thioglobus autotrophicus Pathway tho00190   Oxidative phosphorylation tho01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:tho00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SP60_04210 Enzymes [BR:tho01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      SP60_04210 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro EcsB Motif Other DBs NCBI-ProteinID:  ALE52488 UniProt:  A0A0M4NIS9 LinkDB All DBs Position 785686..785952 Genome browser AA seq 88 aa AA seqDB search MKIKKQSTIVETVVFLLLIVLTLVTYQVGKMGLSGVNISLGVFAIALFKGALISEHFMQL KHASGLWRWMILIWLILLGIVIYLAFTA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaagataaaaaaacaatcaacaatcgtagagacagtagtttttttgctattgatagtg ctaaccttggtgacttatcaggttggcaaaatggggctgtctggcgttaacatatcctta ggtgtgtttgctattgctctttttaagggcgcgctaattagcgagcattttatgcaacta aaacacgctagcggtctttggcgctggatgattttaatttggcttatactgttgggtatt gttatttacctagcatttacggcatag

DBGET integrated database retrieval system