Candidatus Thioglobus autotrophicus: SP60_07840 Help Entry SP60_07840        CDS       T04079                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tho  Candidatus Thioglobus autotrophicus Pathway tho01100   Metabolic pathways tho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SP60_07840    00074 Mycolic acid biosynthesis     SP60_07840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SP60_07840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALE53105 UniProt:  A0A0M3TUK9 LinkDB All DBs Position complement(1444555..1444782) Genome browser AA seq 75 aa AA seqDB search MSIEERVKKVVSEQLDVSGDIDNNASFIDDLGADSLDTVELVMSLEEEFDCEIPDDQAEN ITTVQQAIDYVNNNL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaggaaagagttaaaaaagttgtatctgagcaattagacgtaagtggtgat attgataataacgcttcatttattgatgacttaggtgcagattctctagacactgttgaa ttggttatgtctcttgaagaagagtttgactgtgaaatccctgacgatcaagcagaaaac attacaacggttcaacaagccattgactacgtcaacaacaatttgtaa

DBGET integrated database retrieval system