Thermosipho sp. 1063: BG95_01025 Help Entry BG95_01025        CDS       T04625                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism thp  Thermosipho sp. 1063 Pathway thp00020   Citrate cycle (TCA cycle) thp00720   Other carbon fixation pathways thp01100   Metabolic pathways thp01110   Biosynthesis of secondary metabolites thp01120   Microbial metabolism in diverse environments thp01200   Carbon metabolism thp01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:thp00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BG95_01025   09102 Energy metabolism    00720 Other carbon fixation pathways     BG95_01025 Enzymes [BR:thp01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BG95_01025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_7 Fer4_2 Fer4_21 Fer4_4 Fer4_6 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_15 Fer4_13 Fer4_3 Fer4_17 Fer4_18 Fer4_8 Motif Other DBs NCBI-ProteinID:  APT71568 LinkDB All DBs Position complement(208113..208340) Genome browser AA seq 75 aa AA seqDB search MAKKQFKVKINYNWCKSCGICYNTCPTKTIIKGEMNRPKVEDHTTCIGCLMCENLCPDFA IDIVEITEEVGEKNG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaaacagtttaaggtgaagataaattataattggtgtaaaagttgcgggata tgctataacacttgtcctacaaaaactattattaagggggaaatgaatagaccaaaagta gaagatcatacaacgtgtataggatgtttgatgtgtgaaaatttatgtccagattttgcc attgacatagttgagattacagaagaagtaggtgaaaaaaatgggtaa

DBGET integrated database retrieval system