Thermosipho sp. 1063: BG95_02660 Help Entry BG95_02660        CDS       T04625                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thp  Thermosipho sp. 1063 Pathway thp01100   Metabolic pathways thp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BG95_02660    00074 Mycolic acid biosynthesis     BG95_02660   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BG95_02660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  APT71866 LinkDB All DBs Position complement(528139..528369) Genome browser AA seq 76 aa AA seqDB search MEKVQKIKEIIAEQLGVDVNEVTEEKSLTDDLGADSLDMVDLVMAFEDEFGIKVEDSDLS KINTVKDIVDLISQRV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaaaaagtgcaaaaaatcaaagaaattatagccgagcaacttggagtagatgttaat gaagttacggaagaaaaaagtttaacagatgatttaggggcagattctttagatatggta gatttagttatggcatttgaagatgagtttggaattaaagtagaagattcggatctttct aaaatcaatacggttaaagatattgttgatttaatcagtcaaagagtataa

DBGET integrated database retrieval system