Thermotoga sp. RQ7: TRQ7_00240 Help Entry TRQ7_00240        CDS       T03669                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism thr  Thermotoga sp. RQ7 Pathway thr00020   Citrate cycle (TCA cycle) thr00720   Other carbon fixation pathways thr01100   Metabolic pathways thr01110   Biosynthesis of secondary metabolites thr01120   Microbial metabolism in diverse environments thr01200   Carbon metabolism thr01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:thr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TRQ7_00240   09102 Energy metabolism    00720 Other carbon fixation pathways     TRQ7_00240 Enzymes [BR:thr01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TRQ7_00240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 LdpA_Fe-S-bd Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_8 Fer4_4 Fer4_13 Fer4_3 Fer4_22 Fer4_17 Motif Other DBs NCBI-ProteinID:  AJG39903 LinkDB All DBs Position 43368..43574 Genome browser AA seq 68 aa AA seqDB search MGYRIEVNYDWCKACKLCSWICPTKAITSDELGRPVIREEKCVGCLRCEKICPEMAIEVL GSEERCQR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgggatatagaatcgaggtaaactacgattggtgcaaggcctgcaaactgtgttcctgg atctgtcccacaaaagccatcacaagcgatgaactgggaagacccgtgatacgcgaagaa aaatgcgtcgggtgtctgagatgcgagaaaatttgtcctgagatggcaatagaggtactg ggaagtgaagaaagatgccagagatga

DBGET integrated database retrieval system