Thermotoga sp. RQ7: TRQ7_04885 Help Entry TRQ7_04885        CDS       T03669                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism thr  Thermotoga sp. RQ7 Pathway thr00010   Glycolysis / Gluconeogenesis thr00020   Citrate cycle (TCA cycle) thr00620   Pyruvate metabolism thr00633   Nitrotoluene degradation thr00640   Propanoate metabolism thr00650   Butanoate metabolism thr00680   Methane metabolism thr00720   Other carbon fixation pathways thr01100   Metabolic pathways thr01110   Biosynthesis of secondary metabolites thr01120   Microbial metabolism in diverse environments thr01200   Carbon metabolism thr01210   2-Oxocarboxylic acid metabolism Module thr_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:thr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     TRQ7_04885    00020 Citrate cycle (TCA cycle)     TRQ7_04885    00620 Pyruvate metabolism     TRQ7_04885    00640 Propanoate metabolism     TRQ7_04885    00650 Butanoate metabolism     TRQ7_04885   09102 Energy metabolism    00720 Other carbon fixation pathways     TRQ7_04885    00680 Methane metabolism     TRQ7_04885   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     TRQ7_04885 Enzymes [BR:thr01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      TRQ7_04885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_10 Fer4_16 Fer4_2 Fer4_4 Fer4_13 Fer4_8 Fer4_3 Fer4_18 Fer4_22 Fer4_15 Motif Other DBs NCBI-ProteinID:  AJG40788 UniProt:  A0A0B5KK81 LinkDB All DBs Position complement(956762..957061) Genome browser AA seq 99 aa AA seqDB search MSLKSWKEIPIGGVIDKPGTAREYKTGTWRVMRPILHKEKCIDCMFCWLYCPDQAIVQEG GIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLGEEG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcccttaaaagctggaaagaaatccccatcggtggtgtcatcgacaaaccgggaacg gcaagagaatacaaaacgggaacatggcgtgttatgaggcccatacttcacaaagaaaaa tgtatagattgtatgttctgctggctgtactgtcctgatcaggcaatcgttcaggaaggc ggaatcatgaagggattcaactacgactactgcaagggttgcggactctgtgcaaacgtc tgtccaaagcaggctatagagatgagacctgagacggagtttctgggtgaggagggatga

DBGET integrated database retrieval system