Thermotoga sp. RQ7: TRQ7_05645 Help Entry TRQ7_05645        CDS       T03669                                  Name (GenBank) ATP F0F1 synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism thr  Thermotoga sp. RQ7 Pathway thr00190   Oxidative phosphorylation thr01100   Metabolic pathways Module thr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:thr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     TRQ7_05645  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:thr00194]     TRQ7_05645 Photosynthesis proteins [BR:thr00194]  Photosystem and electron transport system   F-type ATPase [OT]    TRQ7_05645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AJG40936 UniProt:  A0A0B5KYZ8 LinkDB All DBs Position 1118658..1118915 Genome browser AA seq 85 aa AA seqDB search MENLSDLAQGLALLGKYLGAGLCMGIGAIGPGIGEGNIGAHAMDAMARQPEMVGTITTRM LLADAVAETTGIYSLLIAFMILLVV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaaaacctgagcgatctcgcacagggactggcacttcttgggaaatatcttggagcg ggactctgcatgggaataggtgccataggaccgggtataggagaaggtaacataggtgcc catgctatggatgccatggcaagacagcctgagatggtcggtaccatcactacaagaatg ctccttgctgacgctgtggcagagacaaccggtatatactcacttctcatagcctttatg atcctcctcgtggtgtga

DBGET integrated database retrieval system