Thermococcus paralvinellae: TES1_0289 Help Entry TES1_0289         CDS       T03005                                  Name (GenBank) Archaeal histone   KO K24450   DNA-binding protein Organism ths  Thermococcus paralvinellae Brite KEGG Orthology (KO) [BR:ths00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ths03036]     TES1_0289 Chromosome and associated proteins [BR:ths03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     TES1_0289 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TFIID-31kDa CENP-S TAF Bromo_TP TFIID-18kDa TFIID_20kDa DUF1931 CENP-X PE DUF4923 PCP_red Motif Other DBs NCBI-ProteinID:  AHF79684 UniProt:  W0I0Z7 LinkDB All DBs Position 267469..267672 Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEEAAKVLAEYLEEYAIELSKKAVEFARHAGRKTVKAED IKLAIKA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccaattgccccaattgacagattgattagaaaggctggtgctgagaga gttagcgaggaggcagccaaggttctcgctgagtaccttgaggagtatgcaattgagctt tcaaagaaggctgttgagtttgccagacacgctggcagaaagacagtcaaggccgaggac atcaagctcgctatcaaggcttga

DBGET integrated database retrieval system