Thermococcus paralvinellae: TES1_1966 Help Entry TES1_1966         CDS       T03005                                  Name (GenBank) 30S ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ths  Thermococcus paralvinellae Pathway ths03010   Ribosome Brite KEGG Orthology (KO) [BR:ths00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TES1_1966   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TES1_1966  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ths03011]     TES1_1966    04121 Ubiquitin system [BR:ths04121]     TES1_1966   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ths04147]     TES1_1966 Ribosome [BR:ths03011]  Ribosomal proteins   Eukaryotes    Small subunit     TES1_1966   Archaea     TES1_1966 Ubiquitin system [BR:ths04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TES1_1966 Exosome [BR:ths04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TES1_1966   Exosomal proteins of colorectal cancer cells    TES1_1966 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_IS1595 Zn_ribbon_11 Zn_ribbon_Nudix Zn_ribbon_RPB9 Zn_ribbon_NUD MqsA_antitoxin Motif Other DBs NCBI-ProteinID:  AHF81341 UniProt:  W0I5E4 LinkDB All DBs Position 1877978..1878130 Genome browser AA seq 50 aa AA seqDB search MGQKWKLYEVKDGKVVRKNKYCPRCGPGVFMANHKDRWACGRCGYTEWKK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atggggcagaagtggaagctttatgaagttaaggatggcaaagttgtaaggaagaacaag tactgcccaagatgcggtcctggagtctttatggcaaatcacaaggatagatgggcttgt ggaaggtgcggctacactgagtggaagaagtga

DBGET integrated database retrieval system