Thalassotalea sp. HSM 43: E2K93_05680 Help Entry E2K93_05680       CDS       T05926                                  Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism tht  Thalassotalea sp. HSM 43 Brite KEGG Orthology (KO) [BR:tht00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tht03110]     E2K93_05680    03029 Mitochondrial biogenesis [BR:tht03029]     E2K93_05680 Chaperones and folding catalysts [BR:tht03110]  Heat shock proteins   HSP10    E2K93_05680 Mitochondrial biogenesis [BR:tht03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     E2K93_05680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  QBY03902 LinkDB All DBs Position complement(1349640..1349930) Genome browser AA seq 96 aa AA seqDB search MSIRPLHDRVIIKRKEVETKSAGGIVLTGSAAEKSTRGEVIAVGNGRILESGEVRPLDVK IGDQVIFSEGYGAKTEKIDGEEVLILSEADILAIVE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgagcattcgtcctttacatgatcgtgtgattatcaagcgtaaagaagttgaaaccaaa tctgctggtggcattgtcttaacgggtagtgcggctgaaaagtcgactcgtggtgaagta attgccgttggtaacggtcgcattcttgaaagcggtgaagttcgtcctttggatgtgaaa atcggtgatcaagtgatcttctctgaaggttacggcgcaaaaaccgaaaaaatcgatggt gaagaagttctgatcctaagcgaagccgacattttggctatcgtagaataa

DBGET integrated database retrieval system