Thauera humireducens SgZ-1: AC731_001770 Help Entry AC731_001770      CDS       T04211                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism thu  Thauera humireducens SgZ-1 Pathway thu00361   Chlorocyclohexane and chlorobenzene degradation thu00362   Benzoate degradation thu00623   Toluene degradation thu01100   Metabolic pathways thu01120   Microbial metabolism in diverse environments thu01220   Degradation of aromatic compounds Module thu_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:thu00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     AC731_001770    00361 Chlorocyclohexane and chlorobenzene degradation     AC731_001770    00623 Toluene degradation     AC731_001770 Enzymes [BR:thu01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      AC731_001770     1.14.13.244  phenol 2-monooxygenase (NADH)      AC731_001770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM DUF4224 aRib Motif Other DBs NCBI-ProteinID:  AMO35784 UniProt:  A0A140IDF9 LinkDB All DBs Position 375720..375989 Genome browser AA seq 89 aa AA seqDB search MSTVFLALQTNEDTRPIIEAILQDNPSAVVDAQPAMVKINADGRLVVRRETIEEITGRAY DLQELQVNLITMSGNLDQTDDEITLFWKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccgtattccttgcattgcagaccaacgaagacacccgcccgatcatcgaggcg atcctgcaggacaacccttcggccgtcgtcgacgcgcagcccgcgatggtgaagatcaac gccgacggccgcctcgtggtgcgtcgcgagacgatcgaggagatcaccggccgcgcctac gacctgcaggagttgcaggtcaacctgatcaccatgtcgggcaatctcgatcagaccgac gacgagatcaccctgttctggaaatcctga

DBGET integrated database retrieval system