Thauera humireducens SgZ-1: AC731_001780 Help Entry AC731_001780      CDS       T04211                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism thu  Thauera humireducens SgZ-1 Pathway thu00361   Chlorocyclohexane and chlorobenzene degradation thu00362   Benzoate degradation thu00623   Toluene degradation thu01100   Metabolic pathways thu01120   Microbial metabolism in diverse environments thu01220   Degradation of aromatic compounds Module thu_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:thu00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     AC731_001780    00361 Chlorocyclohexane and chlorobenzene degradation     AC731_001780    00623 Toluene degradation     AC731_001780 Enzymes [BR:thu01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      AC731_001780     1.14.13.244  phenol 2-monooxygenase (NADH)      AC731_001780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  AMO35786 UniProt:  A0A140IDG1 LinkDB All DBs Position 377600..377959 Genome browser AA seq 119 aa AA seqDB search MAVVAISKYDFAPADTRDKFHGAQLLYIGWEDHLLFCAPFCFPFPPTMRFGDVVAGPMKA AFGYHPDFARIDWAKVEWLKSGKPFAPDFDKSLADNGLGHKDVIRFRTPGLTGIKGSCS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggctgtagtcgccatttccaagtacgacttcgcgcccgccgacaccagggacaagttc cacggcgcgcaactgctctacatcggctgggaagaccatctgctgttctgcgccccgttc tgcttcccctttccgccgacgatgcgtttcggcgacgtggttgccggaccgatgaaggcc gccttcggttaccacccggactttgcccggatcgactgggcgaaggtcgagtggctgaag tccggcaagccgttcgcgcccgacttcgacaagtcgctcgccgacaacggcctcgggcac aaggacgtaatccgcttccgcacgccgggcctgaccggcatcaagggttcgtgcagctga

DBGET integrated database retrieval system