Thauera humireducens SgZ-1: AC731_006790 Help Entry AC731_006790      CDS       T04211                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thu  Thauera humireducens SgZ-1 Pathway thu01100   Metabolic pathways thu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AC731_006790    00074 Mycolic acid biosynthesis     AC731_006790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AC731_006790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AMO36674 UniProt:  A0A127K4W9 LinkDB All DBs Position complement(1430473..1430712) Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKIESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaaaaagatcgtcgctgagcaacttggcgtgaacgaa tcggagatcaagatcgagtcttcgttcgtcgatgatcttggcgcggattcgctggacacc gtggagctggtcatggccctcgaagaagaattcgagtgcgaaatcccggacgaagaggcc gagaagatcaccaccgtccagcaggcgattgactacgtcaacgcccatctcaagaagtaa

DBGET integrated database retrieval system