Thauera humireducens SgZ-1: AC731_008375 Help Entry AC731_008375      CDS       T04211                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism thu  Thauera humireducens SgZ-1 Pathway thu00362   Benzoate degradation thu00621   Dioxin degradation thu00622   Xylene degradation thu01100   Metabolic pathways thu01120   Microbial metabolism in diverse environments thu01220   Degradation of aromatic compounds Module thu_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:thu00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     AC731_008375    00622 Xylene degradation     AC731_008375    00621 Dioxin degradation     AC731_008375 Enzymes [BR:thu01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      AC731_008375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 FAZ1_cons F420_oxidored Motif Other DBs NCBI-ProteinID:  AMO36960 UniProt:  A0A127K4S7 LinkDB All DBs Position 1764694..1764882 Genome browser AA seq 62 aa AA seqDB search MPTFHIELFEGRSPEKKRELVEALTRETCRVLDCEAGAVDIILVEVKREHWATGGVLWSE RA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgcccaccttccatatcgaactcttcgaaggccgcagtccggagaaaaaacgcgaactc gtcgaggcgctgacgcgcgaaacctgtcgcgtcctcgactgcgaggccggcgctgtcgac atcatcctggtcgaggtcaagcgcgagcactgggcgacgggcggcgtgctctggtccgag cgcgcttga

DBGET integrated database retrieval system