Thermoflexus hugenholtzii: KNN16_09660 Help Entry KNN16_09660       CDS       T07254                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism thug  Thermoflexus hugenholtzii Pathway thug00020   Citrate cycle (TCA cycle) thug00720   Other carbon fixation pathways thug01100   Metabolic pathways thug01110   Biosynthesis of secondary metabolites thug01120   Microbial metabolism in diverse environments thug01200   Carbon metabolism thug01210   2-Oxocarboxylic acid metabolism Module thug_M00009   Citrate cycle (TCA cycle, Krebs cycle) thug_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:thug00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KNN16_09660   09102 Energy metabolism    00720 Other carbon fixation pathways     KNN16_09660 Enzymes [BR:thug01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KNN16_09660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_9 Fer4_2 Fer4_6 Fer4_4 Fer4_10 Fer4_8 Fer4_16 Fer4_17 LdpA_Fe-S-bd Fer4_22 Fer4_13 Fer4_3 Fer4_15 Fer4_18 Gp6_2nd Motif Other DBs NCBI-ProteinID:  QWK09633 LinkDB All DBs Position complement(2109530..2109802) Genome browser AA seq 90 aa AA seqDB search MRVYARQPLNLTQVRIPRGQVFLIPERCKGCQMCVEFCPQQVLRMSSRMNSRGYHYPEIA PGKENACVHCEFCMMVCPEFAIFTLEVDSA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcgggtctacgctcggcagccgctgaacctgacccaggttcggatcccacgggggcag gttttcctcatccccgagcgctgcaagggctgtcagatgtgtgtggagttctgtccccag caggtgctccgcatgtccagccggatgaactcgcgcggttaccactacccggagatcgcg cccggcaaagagaacgcctgtgtccattgcgagttctgcatgatggtctgcccggagttc gccatcttcacccttgaggtggactcggcatga

DBGET integrated database retrieval system