Thermococcus sp. 2319x1: ADU37_CDS15500 Help Entry ADU37_CDS15500    CDS       T04245                                  Name (GenBank) Archaeal histone   KO K24450   DNA-binding protein Organism thv  Thermococcus sp. 2319x1 Brite KEGG Orthology (KO) [BR:thv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thv03036]     ADU37_CDS15500 Chromosome and associated proteins [BR:thv03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     ADU37_CDS15500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CENP-S TFIID-31kDa Bromo_TP TAF TFIID-18kDa TFIID_20kDa DUF1931 LonB_AAA-LID CENP-X DUF4923 Motif Other DBs NCBI-ProteinID:  ALV63249 UniProt:  A0A0U3SZY8 LinkDB All DBs Position 1304549..1304752 Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEEAAKILAEYLEEYAVELGKKAVEFARHAGRKTVKAED IKLAIKA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccaattgccccaattgacagattgattagaaaggctggtgccgagaga gttagtgaagaggccgccaagatactcgccgagtacctcgaagaatacgcggtcgagctc ggaaagaaggctgttgaattcgctagacacgccggcagaaagacagtcaaagccgaggac attaagcttgcaatcaaggcttga

DBGET integrated database retrieval system