KEGG   Thioclava nitratireducens: BMG03_08305
Entry
BMG03_08305       CDS       T04697                                 
Name
(GenBank) NADH:ubiquinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
thw  Thioclava nitratireducens
Pathway
thw00190  Oxidative phosphorylation
thw01100  Metabolic pathways
Module
thw_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:thw00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BMG03_08305
Enzymes [BR:thw01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BMG03_08305
SSDB
Motif
Pfam: Oxidored_q3
Other DBs
NCBI-ProteinID: AQS47806
UniProt: A0ABM6IGC5
LinkDB
Position
1718480..1719088
AA seq 202 aa
MTVFAFAFYLFAITALVAGFMVVISKNPVHSVLWLILTFLSAAGLFVLLGSEFVAMLLII
VYVGAVAVLFLFVVMMLDIDFAALKGELARYMPLGLLIAVIMLVQLGIAFGAWQTSGMAE
NLRADPVPEGMTNAQAIGLLVYDKYLYLFQTAGLILLVAMIGAILLTLRHRTNVKRQNVI
AQMHRDPSKTMEMVDVKPGQGL
NT seq 609 nt   +upstreamnt  +downstreamnt
atgacggtgtttgctttcgccttctaccttttcgccattacggcgttggtcgcgggcttc
atggtggtgatttccaagaacccggtccactcggtgctctggctgatcctgaccttcctg
tcggcggcggggcttttcgtgcttctgggctcggaattcgtcgcaatgctgctgatcatc
gtctatgtcggcgcggtcgcggtgctcttcctcttcgtggttatgatgctcgacatcgat
ttcgccgcgctcaagggggagttggcgcgctacatgccgctgggtcttctgatcgcggtc
atcatgctggtgcagctgggcatcgccttcggggcgtggcagacctccggcatggcggaa
aacctccgtgccgatccggtgcccgagggcatgaccaacgcgcaggcgatcggtctgctc
gtctatgacaaatacctctacctcttccagacggcgggcctgatcctgctggtggcgatg
atcggggcgatcctgctgacgctgcgccatcgcaccaacgtcaagcgccagaacgtcatc
gcgcagatgcatcgcgatccgtccaagacgatggaaatggtggacgtcaaaccggggcag
gggctgtga

DBGET integrated database retrieval system