Thioclava nitratireducens: BMG03_10980 Help Entry BMG03_10980       CDS       T04697                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism thw  Thioclava nitratireducens Pathway thw02024   Quorum sensing thw03018   RNA degradation Brite KEGG Orthology (KO) [BR:thw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BMG03_10980  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BMG03_10980  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:thw03019]     BMG03_10980    03036 Chromosome and associated proteins [BR:thw03036]     BMG03_10980 Messenger RNA biogenesis [BR:thw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BMG03_10980 Chromosome and associated proteins [BR:thw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BMG03_10980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM AcMNPV_AC11 Motif Other DBs NCBI-ProteinID:  AQS49842 UniProt:  A0ABM6IM02 LinkDB All DBs Position complement(2295193..2295426) Genome browser AA seq 77 aa AA seqDB search MAGDKQNLQDAFLNHVRKTKVPVTIFLINGVKLQGVITWFDNFCVLLRRDGQSQLVYKHA ISTIMPGQPISLYEGDD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctggcgacaaacagaacctgcaagacgcatttctcaatcatgtgcgcaagacaaag gttcctgtcacgatcttcctgatcaacggggtgaagctgcagggcgtcatcacctggttt gacaacttctgtgtgcttctgcgccgcgacgggcaatctcagcttgtttacaagcacgcg atctcgacgatcatgccgggacaacctatctcgctttacgaaggcgacgactaa

DBGET integrated database retrieval system