Thermococcus sp. P6: A3L12_00825 Help Entry A3L12_00825       CDS       T05739                                  Name (GenBank) 50S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism thy  Thermococcus sp. P6 Pathway thy03010   Ribosome Brite KEGG Orthology (KO) [BR:thy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A3L12_00825   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A3L12_00825  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thy03011]     A3L12_00825    04121 Ubiquitin system [BR:thy04121]     A3L12_00825 Ribosome [BR:thy03011]  Ribosomal proteins   Eukaryotes    Large subunit     A3L12_00825   Archaea     A3L12_00825 Ubiquitin system [BR:thy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A3L12_00825 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_Ribbon_1 DZR Zn_ribbon_RPAB4 Ribosomal_L40e Toxin_5 DZR_2 Zn_ribbon_3 Zn_ribbon_10 HVO_0416 HypA Motif Other DBs NCBI-ProteinID:  ASJ09944 LinkDB All DBs Position 136678..136836 Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYVCMRCGATNPWKAKKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagattccctgaggctgaggccagaatattcagaaagtacgtctgcatgcgttgc ggtgccacgaacccgtggaaagccaaaaagtgcagaaagtgtggttacaagggtctccgc ccgaaggccagagagccacgcggtggaatgggacgctga

DBGET integrated database retrieval system