Thermococcus sp. P6: A3L12_03250 Help Entry A3L12_03250       CDS       T05739                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism thy  Thermococcus sp. P6 Pathway thy03010   Ribosome Brite KEGG Orthology (KO) [BR:thy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     A3L12_03250   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     A3L12_03250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thy03011]     A3L12_03250    04121 Ubiquitin system [BR:thy04121]     A3L12_03250   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thy04147]     A3L12_03250 Ribosome [BR:thy03011]  Ribosomal proteins   Eukaryotes    Small subunit     A3L12_03250   Archaea     A3L12_03250 Ubiquitin system [BR:thy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    A3L12_03250 Exosome [BR:thy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    A3L12_03250   Exosomal proteins of colorectal cancer cells    A3L12_03250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_NUD Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_IS1595 Zn_Ribbon_TF Zn_ribbon_RPB9 GFA Zn_ribbon_3 MqsA_antitoxin Zn_Ribbon_1 DZR Motif Other DBs NCBI-ProteinID:  ASJ10385 LinkDB All DBs Position complement(613416..613568) Genome browser AA seq 50 aa AA seqDB search MGQKWKLYEVKGGKVKRKNRFCPRCGPGVFMADHGDRWSCGRCGYTEWKR NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atggggcagaagtggaagctctacgaggttaagggtggcaaggtcaagaggaagaacagg ttctgcccgcgctgtggtcccggagtgttcatggcggaccacggggaccgctggagctgc ggaaggtgcggttacacggagtggaaaaggtaa

DBGET integrated database retrieval system