Thermotomaculum hydrothermale: TTHT_1163 Help Entry TTHT_1163         CDS       T06993                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism thyd  Thermotomaculum hydrothermale Pathway thyd03020   RNA polymerase Brite KEGG Orthology (KO) [BR:thyd00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     TTHT_1163  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:thyd03021]     TTHT_1163    03400 DNA repair and recombination proteins [BR:thyd03400]     TTHT_1163 Enzymes [BR:thyd01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      TTHT_1163 Transcription machinery [BR:thyd03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      TTHT_1163 DNA repair and recombination proteins [BR:thyd03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       TTHT_1163 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  BBB32694 UniProt:  A0A7R6PHH9 LinkDB All DBs Position complement(1219294..1219557) Genome browser AA seq 87 aa AA seqDB search MTAEETLKKVLENPFRLILVAGERVEQLRKGAKPKAKAPINKPTFIALEELKQGKFEIRL IEREKEEEGFSAEDLDSLVDEIEVTEE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgactgctgaagaaacacttaaaaaggtacttgaaaatcctttcaggttaattttagtt gccggagagagggttgaacaattgaggaaaggggcaaagccaaaggcaaaggcgcctatt aacaaaccaacctttattgcccttgaagaattaaaacaggggaaatttgaaattaggctt attgaaagagagaaggaagaggaaggattctcagctgaagaccttgattctctggttgac gaaattgaagtaacagaagaataa

DBGET integrated database retrieval system