Thermotoga sp. Cell2: CELL2_04350 Help Entry CELL2_04350       CDS       T03495                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism thz  Thermotoga sp. Cell2 Pathway thz02020   Two-component system thz02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:thz00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CELL2_04350  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CELL2_04350  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:thz02035]     CELL2_04350 Bacterial motility proteins [BR:thz02035]  Flagellar system   Flagellar assembly proteins    Others     CELL2_04350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Cytidylate_kin DUF6033 RedAm-like_C Motif Other DBs NCBI-ProteinID:  AIY88175 LinkDB All DBs Position 839713..839991 Genome browser AA seq 92 aa AA seqDB search MIDRINGPGDINPIEGIKKPSVEKSKEKRKKESTDNVELRHVEDVRKFAEEAKNISTVRE QLVEELKKAIESGNYFVDTERLARKILEELSE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgatagacagaataaacggaccgggagatataaatcctatcgaaggaataaagaagcct tctgtagaaaaatcaaaggagaagaggaaaaaggaaagcaccgataatgttgagcttcgg cacgtcgaagatgtcagaaaattcgctgaagaggcgaaaaacatatcaactgtccgcgag cagctggtagaagagctgaaaaaggccatagagagtggaaattacttcgtcgatactgaa aggcttgcccgaaaaattctggaggagctgtccgaatga

DBGET integrated database retrieval system