Thiomicrorhabdus immobilis: THMIRHAM_08420 Help Entry THMIRHAM_08420    CDS       T08420                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tib  Thiomicrorhabdus immobilis Pathway tib01100   Metabolic pathways tib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tib00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THMIRHAM_08420 (acpP)    00074 Mycolic acid biosynthesis     THMIRHAM_08420 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     THMIRHAM_08420 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  BCN93057 UniProt:  A0ABM7MCE3 LinkDB All DBs Position 962746..962979 Genome browser AA seq 77 aa AA seqDB search MSSIEDRVKKIVVEQLGVEEDQVTADASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKISTLAQATAYVEANL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcagtattgaagatcgcgtaaagaaaatcgtagttgagcaattaggtgtagaagaa gatcaggtaacagctgatgcttctttcgtagatgatttaggtgcggattctctagataca gttgaattagtaatggctctagaagaagagttcgattgcgaaatccctgatgaagaagct gaaaaaatctctactttagctcaagctactgcttacgtagaagctaacctataa

DBGET integrated database retrieval system