Thiomicrorhabdus immobilis: THMIRHAM_08740 Help Entry THMIRHAM_08740    CDS       T08420                                  Symbol acpC Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tib  Thiomicrorhabdus immobilis Pathway tib01100   Metabolic pathways tib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tib00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THMIRHAM_08740 (acpC)    00074 Mycolic acid biosynthesis     THMIRHAM_08740 (acpC)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     THMIRHAM_08740 (acpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCN93089 LinkDB All DBs Position 1000178..1000447 Genome browser AA seq 89 aa AA seqDB search MSALTPEQLEIAELIIEAVNLEDIEAEEINPDDPIFTNGLGLDSIDALEISLELSKKYGV KIGAGDENVNEIFSSVASLTDYVQKNKKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcagctttaacaccagaacaactagaaattgcagaacttattattgaggccgtgaat ctagaggatattgaggctgaagaaattaatccagatgatccaatttttaccaatggatta gggttagactcaattgatgcgcttgaaatttctttggaattgagtaaaaagtatggcgtt aaaatcggtgctggagatgaaaatgttaatgagattttttcatcggttgcttcattaacg gattacgttcaaaaaaataaaaagagctga

DBGET integrated database retrieval system