Thermococcus indicus: FH039_02320 Help Entry FH039_02320       CDS       T07099                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tic  Thermococcus indicus Pathway tic03010   Ribosome Brite KEGG Orthology (KO) [BR:tic00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FH039_02320   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FH039_02320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tic03011]     FH039_02320    04121 Ubiquitin system [BR:tic04121]     FH039_02320   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tic04147]     FH039_02320 Ribosome [BR:tic03011]  Ribosomal proteins   Eukaryotes    Small subunit     FH039_02320   Archaea     FH039_02320 Ubiquitin system [BR:tic04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FH039_02320 Exosome [BR:tic04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    FH039_02320   Exosomal proteins of colorectal cancer cells    FH039_02320 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB MqsA_antitoxin Ribosomal_L37e Lar_restr_allev Zn_ribbon_IS1595 Zn_ribbon_RPB9 Motif Other DBs NCBI-ProteinID:  QDA30683 UniProt:  A0A4Y5SIQ4 LinkDB All DBs Position complement(452232..452405) Genome browser AA seq 57 aa AA seqDB search MAKGKKTSQKWKLYEVQGGKVKRKGKFCPRCGPGVFMAEHKDRWSCGRCGYTEWKRK NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggctaagggcaagaagaccagccagaagtggaagctctacgaggttcagggcggaaag gtcaagaggaagggcaagttctgcccgcgctgcggtccgggcgtcttcatggccgagcac aaggaccgctggagctgcggccgctgcggctacaccgagtggaagaggaagtga

DBGET integrated database retrieval system