Thioploca ingrica: THII_2794 Help Entry THII_2794         CDS       T03616                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tig  Thioploca ingrica Pathway tig01100   Metabolic pathways tig01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tig00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     THII_2794    00074 Mycolic acid biosynthesis     THII_2794   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     THII_2794 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  BAP57091 UniProt:  A0A090BVM0 LinkDB All DBs Position complement(3364327..3364584) Genome browser AA seq 85 aa AA seqDB search MSQETVINRLKDVISQELDANITREEIGNDTPLFEEGLGLDSVVLVELISLVEKEFGIKF SDDELRPESFSTVKVLADVVTGKQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtctcaagagaccgttatcaatcgcctgaaagatgttatttctcaagaactggatgct aacatcactcgggaagaaattggtaacgataccccactgtttgaagaaggtttaggtctg gattctgtcgttttggtggagttaatttcgctggtggaaaaagaattcgggattaaattc tctgacgatgaactccgaccggaatcctttagtacagtcaaagtcctggcggatgtggtc acgggcaaacaaggctag

DBGET integrated database retrieval system