Tuwongella immobilis: GMBLW1_19430
Help
Entry
GMBLW1_19430 CDS
T06428
Name
(GenBank) unnamed protein product; BLAST_uniprot: no_hits
Organism
tim
Tuwongella immobilis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
VTS00137
UniProt:
A0A6C2YKW7
LinkDB
All DBs
Position
1:complement(1812746..1814344)
Genome browser
AA seq
532 aa
AA seq
DB search
MSMAPNGSMSSTRQQLDELDQLLQRMLSLPLSQLEQGLPSMPPLTSASTPPAPQSPLTSA
LPASPLASPTPPLPASGFGTPSSAFAKLPPSALGTTTPPAAAPSYPASQPQAVPAYGTTP
PASPMLGSSFNPIPPMASAPSTPDVPAPSPYLYPQAPAPQPPAAPVMPAAPMSQPLVQNP
FAHSVPTPGYPPSPAAQPAAYSAPTPVAAPTPVAAPTPPAAPQYAPQPATPYALAPASPM
MMPQPPAQPPMAEYRPPVAQAPQMPQTPTASAPAPTMPSMPLQPPVSNAPILPGQAAAQP
SVFDSSWKVELPPGETQPARPQTIFAAWTADQALPGTVSFPGGPPKRESRGPVKLQPLHD
DLPSESKLIRFESSLSDPPPPPRLDQLPPPMSANEPPQSYTFGGPSAGAAKPPVSQLPPV
EQLQPPREGAQLPMSQAVPTPTPIPEPVSSVIPTPATAGVATATAHDRIPVILWPMAATN
WVLEGTLNLMGPPGRLITSPAGKSLLGWSGILMILGSIGFGAAEWFGIDWTP
NT seq
1599 nt
NT seq
+upstream
nt +downstream
nt
atgtcgatggcacccaacggctcgatgagttcgacccgacagcagctcgacgaattggat
caactgctgcaacgcatgctctcgcttccgttatctcaactggagcaaggacttccgtcg
atgccgccgctgacatcggcttcgacgccccccgctccgcaatcgccgctgacatcggcc
ttacccgcctccccgctggcatccccgacaccgccgttgcccgcaagcggcttcggcacc
ccctcgtccgcattcgccaaactgccgccatcggccttggggacaaccaccccacccgct
gccgcacccagctacccggcatcgcaaccgcaagccgttccggcatatggaacgactcca
cccgcatcgccaatgcttggttcgagcttcaacccgattccgccgatggcgtccgcgcct
tcgaccccggatgtaccggctccatcgccgtatttatatccccaagcacccgcgccacag
ccacccgccgcgccggtgatgcccgcggctccgatgtcgcaaccactggtccagaatccg
tttgcgcacagcgtgccgacgccgggctatccgccatcgcccgcggcccaaccggccgcc
tattccgccccaacgccggtggccgccccaacgccggtggccgccccaacgccgcccgca
gccccgcaatatgcaccgcaaccagcgactccctacgcgctcgcaccggcatcgccgatg
atgatgccgcaaccgccggctcagccgccgatggccgagtatcgtccgcccgtggcgcaa
gccccacaaatgccacaaacgccgacagcatcggcacctgcgccaacgatgccgtcgatg
ccgctgcaaccgccggtcagcaacgctccgattttgcccggtcaagctgccgcacaaccg
tcggtcttcgattcatcgtggaaggtcgaacttccgccaggcgaaacgcaaccggcacgc
ccgcagacgattttcgccgcgtggacggccgatcaagcgctgcccggcacggtcagtttt
cccggtggtccgccgaaacgggaatcgcgtggcccggtcaagctccaaccgctgcacgat
gatcttccttcggaatcgaagctgattcgctttgaatcgtcgctgtcggacccaccgccg
ccgccgcgattggatcaactgccgccaccgatgtcggcaaacgagccaccgcaaagctac
acctttggcggaccttctgcgggggccgcgaaaccgccggtctcgcaattgccgccggtg
gaacagctccagccgccgcgcgaaggtgcgcaactgccgatgagtcaagccgttccgaca
ccgacaccgattcccgaaccggtgagcagcgtcatccccaccccggcaaccgcaggcgtg
gcgacggcaacggctcacgatcgcatccccgtcattctgtggccgatggcagccaccaac
tgggtgctggaaggcacgctgaacctgatgggccccccgggccgactcatcacctcccct
gcgggcaagtcgctgctgggatggagtgggattctgatgattcttggttcaatcggcttc
ggagccgccgagtggttcgggatcgattggactccctga
DBGET
integrated database retrieval system