KEGG   Tuwongella immobilis: GMBLW1_43820
Entry
GMBLW1_43820      CDS       T06428                                 
Name
(GenBank) thiamine pyrophosphate n-terminal tpp binding domain protein : Thiamine pyrophosphate-dependent enzyme, possible carboligase or decarboxylase OS=Singulisphaera acidiphila (strain ATCC BAA-1392 / DSM 18658 / VKM B-2454 / MOB10) GN=Sinac_2269 PE=4 SV=1: TPP_enzyme_N: TPP_enzyme_M: TPP_enzyme_C
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
tim  Tuwongella immobilis
Pathway
tim00290  Valine, leucine and isoleucine biosynthesis
tim00650  Butanoate metabolism
tim00660  C5-Branched dibasic acid metabolism
tim00770  Pantothenate and CoA biosynthesis
tim01100  Metabolic pathways
tim01110  Biosynthesis of secondary metabolites
tim01210  2-Oxocarboxylic acid metabolism
tim01230  Biosynthesis of amino acids
Module
tim_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
tim_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:tim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GMBLW1_43820
   00660 C5-Branched dibasic acid metabolism
    GMBLW1_43820
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    GMBLW1_43820
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    GMBLW1_43820
Enzymes [BR:tim01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     GMBLW1_43820
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M Ubiquitin_3
Other DBs
NCBI-ProteinID: VTS06982
UniProt: A0A6C2YTU5
LinkDB
Position
1:complement(5449778..5451667)
AA seq 629 aa
MEFRLNRRDWIQSTALLTGAAAVSTTQSASAEIHGLRADGTVTGSLTGAMAVVDTLRSEG
VRCVFGIPGAQENELWDTFKQRGLDYLLVTHEFSASCMADGYARASGQPGVLCVVPGPGV
TNAMTGLGEALLDSIPLVAIVGDIARGEKYRPFQVHALDQVALLKPVTKAVYLVESVEQI
PDAIRTAFAQAKCGEPGPVAVVIPWTLFIEKAGVHSPPRGPQPVPWDEANFQAALAILRD
PRRRVGIYAGLGCMDSGPTLACVAELLQAPVATSVSGKGCIPETHRLAVGWGYGAHATRT
AEKIFAGEPLHPFRSGVDTLLAIGVKFSEVSTGFYSNPQPKTVIHVDANACNLGQVLQTD
VKVHADANVFLQRLLGCGEMIRRPTDERLLNRIATLKADDAAEHARDLRTDSGVEPTALI
LALRRAIPANGLFYVDVTVSEHTAAEAYTTCLPRTYFNPTDNQAMGWSIPAAIGGAVACP
GRVVATLTGDGCFLMSALELSTAAREQIPVKFFVLDDHTYHYMQLLQQPAYGRTTATVLA
KMDYCSLARGLGIGYLEIHQPGNLDAQVRHALACPGPILIRVRTQYTTRPVRWLESVRGR
FTDELSTRQKARFLARIGARSLHLRDRSD
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggaattccgcttgaatcgacgcgattggatccaatccacggccctgctgaccggcgcg
gccgctgtcagcaccacgcaatcggcctccgcagaaatccacggcttgcgtgccgatggc
accgtcaccggctcactcaccggagccatggcggtggtcgatacgttgcgatccgaaggg
gtacgctgcgtgttcggcatccccggtgcccaagaaaacgaactctgggataccttcaaa
cagcgtgggttggactatcttctggtcacccatgaattttccgcctcgtgcatggccgat
ggatatgctcgcgcttcggggcagcccggcgtgctgtgcgtggtgcccggccccggagtc
accaacgcgatgaccggcctgggcgaggcgctgctagatagcattccgctggtggcgatt
gtcggcgatattgcccgtggcgagaaatatcggccgttccaagtgcatgcgctggatcag
gttgcgctgctcaagccggtgaccaaggccgtctatctggtcgaaagtgtggagcagatt
cccgatgccatccgcacggcattcgctcaggcgaaatgcggtgagccggggccggtggcg
gtggtgatcccctggacgctgttcatcgagaaagccggggtgcattcgccgccacgaggc
ccgcagccggttccgtgggatgaggcgaattttcaggccgcgctggcgattctgcgcgat
ccgcgccgtcgggtgggaatctacgcggggctgggctgcatggatagtgggccgacgctc
gcttgtgtggcggagctgttgcaagcgcccgtagcaacgagtgtttccggcaaggggtgc
attcccgagacgcatcggcttgccgtcggctggggttatggtgcgcatgcgacgcgcacc
gctgagaagatttttgccggcgagccgctgcatccgtttcggagcggggtggacacgctt
ttggccatcggtgtgaaattctccgaagtttcgacgggcttttattccaatccgcagccg
aaaacggtgatccatgtcgatgccaatgcctgcaatttggggcaggtgttgcaaacggat
gtcaaggtgcatgcggatgcgaatgtcttcttgcaacgactgctgggttgtggcgagatg
atccgtcggccgaccgatgaacggctgctcaatcggattgccacgctgaaggccgacgat
gccgccgagcatgcgcgcgatctgcggaccgattccggagtggagccgacggcgctgatt
ctggcgctgcggcgggcgattccggcgaatggattattctacgtggatgtcaccgtttcc
gaacataccgcagcggaggcgtacaccacttgtctgccgcgaacgtacttcaatccgacc
gataatcaagcgatggggtggagcattcctgcggcgattggcggggcggtggcctgtccg
gggcgagtggtggcgacgctgaccggggatggctgtttcctgatgtctgcgttggagtta
tcgacagcggcccgcgaacagatcccagtgaaattcttcgtgctggacgatcacacctat
cactacatgcagttgctgcaacaaccggcgtatggtcgcacgaccgcgacggtgttggcg
aaaatggattattgcagcttggctcgcgggttgggcattggctatctggagatccatcag
ccggggaatttggatgcccaggtgcggcatgcgctggcgtgcccggggccaattctgatt
cgtgtgcgaacgcaatacaccacgcgcccggttcgctggctggaatcggtgcggggacga
tttaccgatgaactgagcacccggcaaaaagcccgattcctcgcccgaatcggggcacgc
tcgctgcatttgcgcgatcgcagcgactga

DBGET integrated database retrieval system