KEGG   Thiomicrolovo immobilis: WCX72_12095
Entry
WCX72_12095       CDS       T11235                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
timm  Thiomicrolovo immobilis
Pathway
timm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:timm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    WCX72_12095 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:timm03011]
    WCX72_12095 (rplR)
Ribosome [BR:timm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    WCX72_12095 (rplR)
  Bacteria
    WCX72_12095 (rplR)
  Archaea
    WCX72_12095 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: XAU05218
LinkDB
Position
complement(2344268..2344624)
AA seq 118 aa
MNAKVLKAKVSKRVQRKRRIRANINGTAAKPRVSIFRSNRYLSVQAIDDASAVTLAASNT
KPLGAKANKEGAAALAADFAGKLKAAGVSEIFFDRNGYVYHGVVAAFADALRANEIKF
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaatgcaaaagtattgaaagcaaaagtttcaaaacgtgttcagcgcaagcgccgcatc
cgtgcaaacatcaacggtacggcagcgaagccgcgcgtcagcatcttccgctctaaccgc
tacctcagcgtccaggcaatcgacgacgcgagcgcggtgacactggcagcttccaacacg
aagccgctgggtgcgaaagcgaacaaagagggtgcggcagcactggcagcggatttcgca
ggcaagctcaaagcagccggcgtcagcgagatcttctttgaccgtaacggttacgtctac
cacggcgtcgttgcggcatttgccgatgctcttcgcgcgaatgaaattaagttttaa

DBGET integrated database retrieval system