Thiomonas intermedia: Tint_0738 Help Entry Tint_0738         CDS       T01227                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism tin  Thiomonas intermedia Brite KEGG Orthology (KO) [BR:tin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tin03110]     Tint_0738 Chaperones and folding catalysts [BR:tin03110]  Protein folding catalysts   Protein disulfide isomerase    Tint_0738 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like DSBA Motif Other DBs NCBI-ProteinID:  ADG30134 UniProt:  D5X6K7 LinkDB All DBs Position 805640..805903 Genome browser AA seq 87 aa AA seqDB search MNKVRMYTSAVCPYCIRAKALLQKRGVVDIEEIRIDLDPGQRQHMMASTGRRTVPQIFIG DIHVGGCDDLYALDARGGLMPLLRDAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggttcgcatgtacacctcagccgtctgtccctattgcatccgcgccaaggcg ctgttgcaaaaacgcggcgtggtggacattgaagaaatccgcatcgatctcgacccgggt cagcgccagcacatgatggcatctaccgggcgccgcaccgtgccgcagattttcataggc gacatccatgtgggcggctgcgacgatctctacgccctcgacgcccggggcggcctgatg cccctgctgcgcgacgccgcctga

DBGET integrated database retrieval system